PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00034637001
Common NameGSBRNA2T00034637001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 312aa    MW: 34082.6 Da    PI: 9.4247
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00034637001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof97.87.2e-3176134361
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          e alkcprC+s ntkfCy nny+ +qPr++CkaCrryWt+GG lr+vP Gg rr+n k+
  GSBRNA2T00034637001  76 EGALKCPRCNSINTKFCYNNNYNPTQPRHYCKACRRYWTHGGKLRDVPEGGRRRRNSKK 134
                          6689**************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2263126IPR003851Zinc finger, Dof-type
PfamPF027016.8E-2978133IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.24579133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MVFSSNWSQP TNPNQLQLNE NGSLVNDHGL LSHQLPPFPP NPNPNHHHAA ASSGLPARLG  60
GFMAERASQT KAPRPEGALK CPRCNSINTK FCYNNNYNPT QPRHYCKACR RYWTHGGKLR  120
DVPEGGRRRR NSKKNKNDNS KSSSTVNAPS SSSGQLRTKH QFPFLPTLQN LTQLGGIGLN  180
LAAANGNNQA HQFGPSLMND LGFLHVGNER NIHDNNNSEN NLMGPGGFPL FDPTSGEGNI  240
GNDVGLSFPS TSMVDSSIYQ TGPVKMEEQP NLVNLSRPVS GLTHPVNQTN QYYWNNSDFS  300
GPSSNDHHQL L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5842840.0FJ584284.1 Brassica rapa subsp. pekinensis OBF binding protein 2 Dof1.1-1 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013602469.10.0PREDICTED: dof zinc finger protein DOF1.1-like
SwissprotQ8L9V61e-129DOF11_ARATH; Dof zinc finger protein DOF1.1
TrEMBLA0A078JCF20.0A0A078JCF2_BRANA; BnaCnng38870D protein
TrEMBLA0A0D3DYJ60.0A0A0D3DYJ6_BRAOL; Uncharacterized protein
STRINGBra031588.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.38e-97Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]